| Read Date | 2007-01-15 10:48:00 |
|---|---|
| Read Number | X0000081601058200701151048 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 7_C0925 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Ammonium phosphate dibasic | 8.0 | 0.1 M | [O-]P([O-])(=O)O.[NH4+].[… |
| PEG 400 | 8.0 | 20.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | GR158 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 182 aa |
| Mass | 21.16 kD |
| ext | 9970 |
| pI | 5.39 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 1WCL (Best Match) |
| Gene | |
|---|---|
| Organism | Archaeoglobus fulgidus |
| Genus | Archaeoglobus |
| Species | fulgidus |
| Strain | |
| Sequence | MNLDELLLLIEKNRSQLSKIDDDFYEKLRERIAELEEMKSSAGESDFFRYEDEIRTLKRLQRKIFELRTGKIISAAWAEVCGQQFSSDVENMCSDERVFFKKLIDIIKEFKRSILEGGKRKISDRVLVRIKKDVEIQGADGKTYKLRREDVVTLPQLNADALIKGGIAERIEVKEDEVSQEG |