| Read Date | 2005-08-12 08:14:00 |
|---|---|
| Read Number | X0000055521164200508120814 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C1035 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 0.5 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | BhR2 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 94 aa |
| Mass | 10.99 kD |
| ext | 26930 |
| pI | 9.81 |
| Name | UPF0213 protein BH0048 |
| Database References | NCBI UniProt |
| PFAM | PF01541 |
| PDB Structures | 1ZG2 (NMR) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | MNHYVYILECKDGSWYTGYTTDVDRRIKKHASGKGAKYTRGRGPFRLVATWAFPSKEEAMRWEYEVKHLSRRKKEQLVSLKGGPYENTTKLSTT |