| Read Date | 2007-01-26 10:20:00 |
|---|---|
| Read Number | X0000082741364200701261020 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1049 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 7.5 | 0.2 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 7.5 | 1.2 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | BhR122 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 173 aa |
| Mass | 19.52 kD |
| ext | 16960 |
| pI | 5.33 |
| Name | Probable 16S rRNA-processing protein rimM |
| Database References | NCBI UniProt |
| PFAM | PF01782 |
| PDB Structures | 3H9N (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | MSKWLNVGKIVNTHGVRGEVRVLSTTDFEDDRFSSGKTLYVMRPNQNERVAVTVASHRKHKNFDLLCFEGYPSINDVEAFKGGRLQVPIEDRPELGEGEFFYHEIIGCSVVTIAGEELGKVKEILSPGANDVWVVQCRRGGKDLLIPYIEQVVKQVDLEKQQITIEPMEGLLE |