 
    | Read Date | 2007-02-24 00:32:00 | 
|---|---|
| Read Number | X0000082751131200702240032 | 
| Week | 5 | 
| Verified Crystal | |
| 3-Way Classifier | crystal | 
| 10-Way Classifier | crystal | 
| Cocktail | 7_C0739 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 | 
| Sodium chloride | 10.0 | 0.1 M | [Na+].[Cl-] | 
| PEG 1000 | 10.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
|  | BhR128 | 
|---|---|
| Spine Status | aggregation screening | 
| Length | 177 aa | 
| Mass | 20.47 kD | 
| ext | 15470 | 
| pI | 6.01 | 
| Name | BH0758 protein | 
| Database References | NCBI UniProt | 
| PFAM | PF09349 | 
| PDB Structures | 2O8I (Best Match) | 
| Gene | |
|---|---|
| Organism | Bacillus halodurans | 
| Genus | Bacillus | 
| Species | halodurans | 
| Strain | |
| Sequence | MMGMAVSTKLSIDEVNMLEKEDFVTKIGPIFEHSPWVAERAWAHRPFTSAENMYECMLEKVYEADKRLQLALLRAHPDLGTRLEISETSQSEQQRAGLSQLTEEEFAVFAELNKCYVDTFRFPFIMAVRGQTKNSIKEQMRKRLVNDEEQERKTALREVAKIAKFRLADLVVMGSRS |