| Read Date | 2007-02-24 00:32:00 |
|---|---|
| Read Number | X0000082751085200702240032 |
| Week | 5 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0164 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Sodium chloride | 7.0 | 1.5 M | [Na+].[Cl-] |
![]() | BhR128 |
|---|---|
| Spine Status | aggregation screening |
| Length | 177 aa |
| Mass | 20.47 kD |
| ext | 15470 |
| pI | 6.01 |
| Name | BH0758 protein |
| Database References | NCBI UniProt |
| PFAM | PF09349 |
| PDB Structures | 2O8I (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | MMGMAVSTKLSIDEVNMLEKEDFVTKIGPIFEHSPWVAERAWAHRPFTSAENMYECMLEKVYEADKRLQLALLRAHPDLGTRLEISETSQSEQQRAGLSQLTEEEFAVFAELNKCYVDTFRFPFIMAVRGQTKNSIKEQMRKRLVNDEEQERKTALREVAKIAKFRLADLVVMGSRS |