| Read Date | 2007-01-26 11:13:00 |
|---|---|
| Read Number | X0000082761442200701261113 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0949 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Potassium nitrate | 10.0 | 0.1 M | [K+].[O-][N+]([O-])=O |
| PEG 400 | 10.0 | 20.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | AtR175 |
|---|---|
| Spine Status | HSQC collected |
| Length | 118 aa |
| Mass | 12.71 kD |
| ext | 4470 |
| pI | 5.78 |
| Name | Hypothetical protein Atu2404 (AGR_C_4363p) |
| Database References | NCBI UniProt |
| PFAM | PF04828 |
| PDB Structures | 3FAC (Best Match) |
| Gene | |
|---|---|
| Organism | Agrobacterium tumefaciens |
| Genus | Agrobacterium |
| Species | tumefaciens |
| Strain | |
| Sequence | MATAHYHGSCQCGSVSFEVDADLDHTVICNCSRCKRLGSTLAFAPREKFTLLSGEDKLSEYLFNKHKIHHFFCSTCGIESFAYADGPDGTPMVAVNANCLDGVDPRALKSQAFDGAAA |