| Read Date | 2007-02-01 11:34:00 |
|---|---|
| Read Number | X0000082971180200702011134 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1039 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.0 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | TaR68 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 150 aa |
| Mass | 17.11 kD |
| ext | 25900 |
| pI | 9.87 |
| Name | 30S ribosomal protein S19e |
| Database References | NCBI UniProt |
| PFAM | PF01090 |
| PDB Structures | 2V7F (Best Match) |
| Gene | |
|---|---|
| Organism | Thermoplasma acidophilum |
| Genus | Thermoplasma |
| Species | acidophilum |
| Strain | |
| Sequence | MVSVKYVPSDLLINYVSEKLKSEKKIAEPDWSKYVKTGISREKSPVNRDWIYVRAAAMLRKLYINGYLGISRMSSEYGGKVDRGSKRYHAAQGSRSIIRYLFHELEKAGYVQKTPKGRSLSPQGMSLLDNASKDIIKQLAEKDPAFQKFI |