| Read Date | 2007-02-01 12:07:00 |
|---|---|
| Read Number | X0000083000848200702011207 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 7_C1400 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| Potassium chloride | 7.5 | 0.2 M | [Cl-].[K+] |
| Pentaerythritol propoxylate (5/4 PO/OH) | 7.5 | 35.0 % (v/v) | C=CCC12CCOS(=O)(=O)NC1C3=… |
![]() | McR1 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 63 aa |
| Mass | 7.19 kD |
| ext | 8480 |
| pI | 5.31 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF05082 |
| PDB Structures | 2JS5 (NMR) |
| Gene | |
|---|---|
| Organism | Methylococcus capsulatus |
| Genus | Methylococcus |
| Species | capsulatus |
| Strain | |
| Sequence | MSEGAEELKAKLKKLNAQATALKMDLHDLAEDLPTGWNRIMEVAEKTYEAYRQLDEFRKSTAS |