| Read Date | 2007-02-02 10:00:00 |
|---|---|
| Read Number | X0000083071391200702021000 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0288 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Rubidium chloride | 9.0 | 0.1 M | [Rb+].[Cl-] |
| PEG 20000 | 9.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SvR230 |
|---|---|
| Spine Status | HSQC collected |
| Length | 201 aa |
| Mass | 21.67 kD |
| ext | 35980 |
| pI | 4.70 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF05719 |
| PDB Structures | 5E56 (Best Match) |
| Gene | |
|---|---|
| Organism | Streptomyces avermitilis |
| Genus | Streptomyces |
| Species | avermitilis |
| Strain | |
| Sequence | MTTPRDLLIVAMDVGSSRYVEPGDLSLALAGAEVIDLLGAGALTLEGDRIVSNNQWTLGDRLLDEAASSLVRQPPHEPVEDWLWRRGRGLSQAYLAALETEGQVARQPGRWLPVRTGRTALVDSPARRHAADRWASGEPVLAVLAAAAGIHDLPTEDSPSIADEAVVTVLAAVNDAVMELEAVRQRRSIEEAAFDNIWRGP |