| Read Date | 2007-02-09 07:13:00 |
|---|---|
| Read Number | X0000083531143200702090713 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 7_C0742 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Sodium nitrate | 7.0 | 0.1 M | [Na+].[O-][N+]([O-])=O |
| PEG 1000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SfR281A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 122 aa |
| Mass | 14.36 kD |
| ext | 6990 |
| pI | 6.92 |
| Name | Periplasmic protein cpxP precursor |
| Database References | NCBI UniProt |
| PFAM | PF07813 |
| PDB Structures | 3QZC (Best Match) |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ |