| Read Date | 2007-02-09 09:53:00 |
|---|---|
| Read Number | X0000083531506200702090953 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 7_C1337 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Lithium sulfate monohydrate | 8.5 | 1.0 M | [Li+].[Li+].[O-]S([O-])(=… |
| Nickel(II) chloride hexahydrate | 8.5 | 0.0 M | [Ni+2].[Cl-].[Cl-].O.O.O.… |
![]() | SfR281A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 122 aa |
| Mass | 14.36 kD |
| ext | 6990 |
| pI | 6.92 |
| Name | Periplasmic protein cpxP precursor |
| Database References | NCBI UniProt |
| PFAM | PF07813 |
| PDB Structures | 3QZC (Best Match) |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQKSSSLKLLSSSNSRSQ |