| Read Date | 2005-09-16 22:33:00 |
|---|---|
| Read Number | X0000055980260200509162233 |
| Week | 6 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 5_C1361 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.6 | 1.3 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.6 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SR324 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 122 aa |
| Mass | 14.03 kD |
| ext | 12950 |
| pI | 5.53 |
| Name | Hypothetical protein yfmB |
| Database References | NCBI UniProt |
| PFAM | PF11486 |
| PDB Structures | 2EUC (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGDIEFALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSRRHGNAAYHLFVSDDAFMRKQ |