| Read Date | 2005-08-19 09:09:00 |
|---|---|
| Read Number | X0000056021365200508190909 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C0090 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 2.5 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | SR342 |
|---|---|
| Spine Status | aggregation screening |
| Length | 119 aa |
| Mass | 14.07 kD |
| ext | 12950 |
| pI | 4.89 |
| Name | Intracellular proteinase inhibitor (BsuPI) |
| Database References | NCBI UniProt |
| PFAM | PF12690 |
| PDB Structures | 3ISY (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MENQEVVLSIDAIQEPEQIKFNMSLKNQSERAIEFQFSTGQKFELVVYDSEHKERYRYSKEKMFTQAFQNLTLESGETYDFSDVWKEVPEPGTYEVKVTFKGRAENLKQVQAVQQFEVK |