| Read Date | 2007-03-16 08:25:00 |
|---|---|
| Read Number | X0000085731373200703160825 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0092 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Manganese chloride tetrahydrate | 4.0 | 1.3 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | BoR132 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 115 aa |
| Mass | 12.87 kD |
| ext | 9970 |
| pI | 6.73 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF04828 |
| PDB Structures | 3FAC (Best Match) |
| Gene | |
|---|---|
| Organism | Bordetella bronchiseptica |
| Genus | Bordetella |
| Species | bronchiseptica |
| Strain | |
| Sequence | MHYHGSCHCGTIRFDVEGELTGAMSCNCSICRRKGALLWFVPRDHLRLATPDEQIATYTFNRHLIKHRFCPTCGIHTHGEGVDQQGRAMAAINIRCLDDVDLDAVAVHQYDGRAA |