Read Date | 2007-03-16 08:40:00 |
---|---|
Read Number | X0000085750546200703160840 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | clear |
Cocktail | 7_C1277 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
HEPES-Na | 7.5 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
Potassium sodium tartrate tetrahydrate | 7.5 | 0.8 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | HR3179 |
---|---|
Spine Status | HSQC collected |
Length | 199 aa |
Mass | 22.74 kD |
ext | 20970 |
pI | 6.32 |
Name | RecName: Full=Death domain-containing protein CRADD;AltName: Full=Caspase and RIP adapter with death domain;AltName: Full=RIP-associated protein with a death domain; |
Database References | NCBI UniProt |
PFAM | PF00619 |
PDB Structures | 2O71 (Best Match) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |