| Read Date | 2007-03-23 11:20:00 |
|---|---|
| Read Number | X0000085751492200703231120 |
| Week | 2 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 7_C1525 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | HR3179 |
|---|---|
| Spine Status | HSQC collected |
| Length | 199 aa |
| Mass | 22.74 kD |
| ext | 20970 |
| pI | 6.32 |
| Name | RecName: Full=Death domain-containing protein CRADD;AltName: Full=Caspase and RIP adapter with death domain;AltName: Full=RIP-associated protein with a death domain; |
| Database References | NCBI UniProt |
| PFAM | PF00619 |
| PDB Structures | 2O71 (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |