| Read Date | 2005-08-19 09:39:00 |
|---|---|
| Read Number | X0000056031512200508190939 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 5_C1530 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium thiocyanate | 7.0 | 0.5 M | C(#N)[S-].[K+] |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | StR75 |
|---|---|
| Spine Status | aggregation screening |
| Length | 148 aa |
| Mass | 16.73 kD |
| ext | 4470 |
| pI | 6.21 |
| Name | Putative cytoplasmic protein |
| Database References | UniProt |
| PFAM | PF12844 |
| PDB Structures | 3J9X (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALNQHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE |