| Read Date | 2007-03-23 11:06:00 |
|---|---|
| Read Number | X0000086091327200703231106 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0752 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Cobalt (II) sulfate heptahydrate | 6.0 | 0.1 M | [Co+2].[O-]S([O-])(=O)=O.… |
| PEG 1000 | 6.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SsR93 |
|---|---|
| Spine Status | HSQC collected |
| Length | 158 aa |
| Mass | 17.99 kD |
| ext | 5960 |
| pI | 9.37 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2LCQ (Best Match) |
| Gene | |
|---|---|
| Organism | Sulfolobus solfataricus |
| Genus | Sulfolobus |
| Species | solfataricus |
| Strain | |
| Sequence | MHIIFDTSGFLSGLQLSLDRVYTTQEVINEIKDKYSRFNLEIAISSGKVIIMKPSTRSVEKVTKVLNLTKERKLSNTDISVIALALDLQPSIVFTDDLSVQNILKQLGIQFSSVKINKKVEKSFKFKYVCVNCKREFNIDHGECPYCGGKVVKRRIME |