| Read Date | 2007-03-30 08:51:00 |
|---|---|
| Read Number | X0000086291348200703300851 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1045 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.4 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SuR46 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 179 aa |
| Mass | 19.72 kD |
| ext | 10430 |
| pI | 6.14 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF09992 |
| PDB Structures | 3OHG (Best Match) |
| Gene | |
|---|---|
| Organism | Streptococcus thermophilus |
| Genus | Streptococcus |
| Species | thermophilus |
| Strain | |
| Sequence | MVKSIVILIETVTMKIPAVYSDGSFKTFNDSETTAQKLVDSGVVNTFAFGPTLVENGKVAVSENEEVGQDMADNPRTAIVVNEESDRSVHYIVIVSDGRTSESSGLTLYEMAELMKSYGVMTGYNLDVGDSSTMYSNGQVINKPTRKRKQNLRKGGERYRLHRLLKNLLASTFSPPILV |