| Read Date | 2007-04-13 07:37:00 |
|---|---|
| Read Number | X0000086731502200704130737 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1336 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| tert-Butanol | 8.5 | 25.0 % (v/v) | CC(C)(C)O |
![]() | BcR114 |
|---|---|
| Spine Status | aggregation screening |
| Length | 263 aa |
| Mass | 31.11 kD |
| ext | 66350 |
| pI | 4.45 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF14024 |
| PDB Structures | 2RA8 (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus cereus |
| Genus | Bacillus |
| Species | cereus |
| Strain | |
| Sequence | METLLIQQTEKSNKFWKIVVKEKDYVVFYGKIGTAGSVKAKEFETEEECMNEANKLVASKRKKGYIDPLPGEDYIKEKTITEEEFWELLHRAKTKGEDQEEQIEWLTSHLAKRTVHEIVAFDTHMHSLLKDSYTSRLWAAAYIIMGGCSDDTFDYFRGWLLYQGKETYEACIEDPERLIPVLENLSEYDVPEIEELSLYFGFTVYAEKTGDEDDTYFTLYHVLSNEEFDDVDFEFDWNEDDEEGLKKVFPRLWEMYGEEPIEW |