| Read Date | 2007-04-13 07:47:00 |
|---|---|
| Read Number | X0000086751392200704130747 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1056 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 8.2 | 1.7 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | DrR43 |
|---|---|
| Spine Status | crystal hits |
| Length | 115 aa |
| Mass | 12.20 kD |
| ext | 4470 |
| pI | 4.68 |
| Name | V-type ATP synthase, F subunit |
| Database References | NCBI UniProt |
| PFAM | PF01990 |
| PDB Structures | 2D00 (Best Match) |
| Gene | |
|---|---|
| Organism | Deinococcus radiodurans |
| Genus | Deinococcus |
| Species | radiodurans |
| Strain | |
| Sequence | MTKGESTMQRIAVLSDAETATGYRLAGATVIEASPEDALRTLEQAITDGGYGLIAVDTGLIPDPATATARIMRGRDLPILLPIPSLRDAFSSDTVDAKAYMGKLVRDTIGFDIKL |