| Read Date | 2007-04-20 09:46:00 |
|---|---|
| Read Number | X0000087401138200704200946 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1317 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium phosphate monobasic | 6.5 | 0.1 M | [K+].[O-]P(=O)(O)O |
| Sodium chloride | 6.5 | 2.0 M | [Na+].[Cl-] |
| Sodium phosphate monobasic monohydrate | 6.5 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| MES monohydrate | 6.5 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | ZR280 |
|---|---|
| Spine Status | aggregation screening |
| Length | 311 aa |
| Mass | 35.87 kD |
| ext | 31860 |
| pI | 6.33 |
| Name | tRNA delta(2)-isopentenylpyrophosphate transferase (EC 2.5.1.8) (IPPtransferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase)(IPTase) (IPPT) |
| Database References | NCBI UniProt |
| PFAM | PF01715 |
| PDB Structures | 3D3Q (Best Match) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | MNKNKPFIVVIVGPTASGKTELSIELAKRINGEIISGDSMQVYKHMNIGTAKVTPEEMDGIPHHLIDILNPDDTFSAYEFKRLAEDLITDITNRGKVPIIAGGTGLYIQSLIYNYELEDETVTPAQLSIVKQKLSALEHLDNQQLHDYLAQFDAVSAENIHPNNRQRVLRAIEYYLKTKKLLSNRKKVQQFTENYDTLLLGIEMSRKTLYSRINKRVDIMLDHGLFREVQQLVEQGYESCQSMQAIGYKELIPVINGQMIYEDAVNDLKQHSRQYAKRQMTWFKNKMSVHWLDKENMSLQMMLDEITTQIK |