| Read Date | 2007-05-04 07:16:00 |
|---|---|
| Read Number | X0000087671334200705040716 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1330 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| Sodium acetate trihydrate | 7.5 | 1.0 M | [Na+].[O-]C(=O)C.O.O.O |
| Cadmium sulfate octahydrate | 7.5 | 0.1 M | [Cd+2].[O-]S([O-])(=O)=O.… |
![]() | DrR87 |
|---|---|
| Spine Status | crystal hits |
| Length | 181 aa |
| Mass | 18.97 kD |
| ext | 23950 |
| pI | 5.79 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF04493 |
| PDB Structures | 3GOC (Best Match) |
| Gene | |
|---|---|
| Organism | Deinococcus radiodurans |
| Genus | Deinococcus |
| Species | radiodurans |
| Strain | |
| Sequence | MILAADVQYGDTGAQAAGVLFTDWPDAAPERTLLVHLPEVAEYVPGEFYRRELPCLLRLVEVVAVPLSAVVVDGYVTLGEDARPGLGWKLWEALGRAVPVVGVAKTAFAGTPAETEVRRGGSHSPLYVTAAGLPLADAKAQVAAMHGPHRLPTLLKQADRLARGLEAASTFGLTTAGQAGK |