| Read Date | 2007-05-11 08:14:00 |
|---|---|
| Read Number | X0000088041318200705110814 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1326 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| MPD | 7.5 | 5.0 % (v/v) | CC(O)CC(C)(C)O |
| PEG 6000 | 7.5 | 10.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | BeR31 |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 150 aa |
| Mass | 15.79 kD |
| ext | 9970 |
| pI | 4.92 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF04430 |
| PDB Structures | 2K2E (NMR) 3CPK (Xray) |
| Gene | |
|---|---|
| Organism | Bordetella pertussis |
| Genus | Bordetella |
| Species | pertussis |
| Strain | |
| Sequence | MKLHTDPATALNTVTAYGDGYIEVNQVRFSHAIAFAPEGPVASWPVQRPADITASLLQQAAGLAEVVRDPLAFLDEPEAGAGARPANAPEVLLVGTGRRQHLLGPEQVRPLLAMGVGVEAMDTQAAARTYNILMAEGRRVVVALLPDGDS |