| Read Date | 2007-05-11 08:16:00 |
|---|---|
| Read Number | X0000088041247200705110816 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 7_C0660 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Potassium thiocyanate | 7.0 | 0.1 M | C(#N)[S-].[K+] |
| PEG 4000 | 7.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | BeR31 |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 150 aa |
| Mass | 15.79 kD |
| ext | 9970 |
| pI | 4.92 |
| Name | NA |
| Database References | NCBI UniProt |
| PFAM | PF04430 |
| PDB Structures | 2K2E (NMR) 3CPK (Xray) |
| Gene | |
|---|---|
| Organism | Bordetella pertussis |
| Genus | Bordetella |
| Species | pertussis |
| Strain | |
| Sequence | MKLHTDPATALNTVTAYGDGYIEVNQVRFSHAIAFAPEGPVASWPVQRPADITASLLQQAAGLAEVVRDPLAFLDEPEAGAGARPANAPEVLLVGTGRRQHLLGPEQVRPLLAMGVGVEAMDTQAAARTYNILMAEGRRVVVALLPDGDS |