| Read Date | 2007-05-14 09:49:00 |
|---|---|
| Read Number | X0000088131348200705140949 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1045 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.4 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SgR8 |
|---|---|
| Spine Status | good HSQC collected |
| Length | 137 aa |
| Mass | 15.32 kD |
| ext | 1490 |
| pI | 10.82 |
| Name | Slr5115 protein |
| Database References | NCBI UniProt |
| PFAM | PF00472 |
| PDB Structures | 4V95 (Best Match) |
| Gene | |
|---|---|
| Organism | Synechocystis sp. |
| Genus | Synechocystis |
| Species | sp. PCC 6803 |
| Strain | |
| Sequence | MLQITKSLSIALTEIEMTALRSQGAGGQNVNKVASAIHLRFDIGASSLPDVYKERLLNLNDQRITKDGIVVIKAQSHRTQEQNREEALKRLQGLISSVITLPKPRRPTKPTRSSQRKRLDAKTKRSAVKALRKSIDE |