| Read Date | 2007-05-22 07:14:00 | 
|---|---|
| Read Number | X0000088370959200705220714 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | crystal | 
| 10-Way Classifier | clear | 
| Cocktail | 7_C0732 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 | 
| Potassium phosphate monobasic | 6.0 | 0.1 M | [K+].[O-]P(=O)(O)O | 
| PEG 1000 | 6.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
![]()  | CgR35 | 
|---|---|
| Spine Status | crystal hits | 
| Length | 259 aa | 
| Mass | 27.56 kD | 
| ext | 9970 | 
| pI | 5.06 | 
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulators of sugar metabolism, DeoR family)  | 
| Database References | NCBI UniProt | 
| PFAM | PF00455 | 
| PDB Structures | 4OOI (Best Match) | 
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum | 
| Genus | Corynebacterium | 
| Species | glutamicum | 
| Strain | |
| Sequence | MYAEERRRQIASLTAVEGRVNVTELAGRFDVTAETIRRDLAVLDREGIVHRVHGGAVATQSFQTTELSLDTRFRSASSAKYSIAKAAMQFLPAEHGGLFLDAGTTVTALADLISEHPSSKQWSIVTNCLPIALNLANAGLDDVQLLGGSVRAITQAVVGDTALRTLALMRADVVFIGTNALTLDHGLSTADSQEAAMKSAMITNAHKVVVLCDSTKMGTDYLVSFGAISDIDVVVTDAGAPASFVEQLRERDVEVVIAE |