| Read Date | 2007-05-22 10:53:00 |
|---|---|
| Read Number | X0000088370943200705221053 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0728 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Potassium nitrate | 5.0 | 0.1 M | [K+].[O-][N+]([O-])=O |
| PEG 1000 | 5.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | CgR35 |
|---|---|
| Spine Status | crystal hits |
| Length | 259 aa |
| Mass | 27.56 kD |
| ext | 9970 |
| pI | 5.06 |
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulators of sugar metabolism, DeoR family) |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures | 4OOI (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MYAEERRRQIASLTAVEGRVNVTELAGRFDVTAETIRRDLAVLDREGIVHRVHGGAVATQSFQTTELSLDTRFRSASSAKYSIAKAAMQFLPAEHGGLFLDAGTTVTALADLISEHPSSKQWSIVTNCLPIALNLANAGLDDVQLLGGSVRAITQAVVGDTALRTLALMRADVVFIGTNALTLDHGLSTADSQEAAMKSAMITNAHKVVVLCDSTKMGTDYLVSFGAISDIDVVVTDAGAPASFVEQLRERDVEVVIAE |