| Read Date | 2007-05-29 13:26:00 |
|---|---|
| Read Number | X0000088370852200705291326 |
| Week | 2 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C1401 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium sulfate | 6.5 | 0.1 M | O=S(=O)(O)O.N.N |
| Bis-Tris | 6.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
| Pentaerythritol ethoxylate (15/4 EO/OH) | 6.5 | 30.0 % (v/v) | C(C(CO)(CO)CO)O |
![]() | CgR35 |
|---|---|
| Spine Status | crystal hits |
| Length | 259 aa |
| Mass | 27.56 kD |
| ext | 9970 |
| pI | 5.06 |
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulators of sugar metabolism, DeoR family) |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures | 4OOI (Best Match) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MYAEERRRQIASLTAVEGRVNVTELAGRFDVTAETIRRDLAVLDREGIVHRVHGGAVATQSFQTTELSLDTRFRSASSAKYSIAKAAMQFLPAEHGGLFLDAGTTVTALADLISEHPSSKQWSIVTNCLPIALNLANAGLDDVQLLGGSVRAITQAVVGDTALRTLALMRADVVFIGTNALTLDHGLSTADSQEAAMKSAMITNAHKVVVLCDSTKMGTDYLVSFGAISDIDVVVTDAGAPASFVEQLRERDVEVVIAE |