Read Date | 2007-06-12 11:20:00 |
---|---|
Read Number | X0000088370752200706121120 |
Week | 4 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | crystal |
Cocktail | 7_C1484 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Sodium nitrate | 7.0 | 1.5 M | [Na+].[O-][N+]([O-])=O |
Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | CgR35 |
---|---|
Spine Status | crystal hits |
Length | 259 aa |
Mass | 27.56 kD |
ext | 9970 |
pI | 5.06 |
Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulators of sugar metabolism, DeoR family) |
Database References | NCBI UniProt |
PFAM | PF00455 |
PDB Structures | 4OOI (Best Match) |
Gene | |
---|---|
Organism | Corynebacterium glutamicum |
Genus | Corynebacterium |
Species | glutamicum |
Strain | |
Sequence | MYAEERRRQIASLTAVEGRVNVTELAGRFDVTAETIRRDLAVLDREGIVHRVHGGAVATQSFQTTELSLDTRFRSASSAKYSIAKAAMQFLPAEHGGLFLDAGTTVTALADLISEHPSSKQWSIVTNCLPIALNLANAGLDDVQLLGGSVRAITQAVVGDTALRTLALMRADVVFIGTNALTLDHGLSTADSQEAAMKSAMITNAHKVVVLCDSTKMGTDYLVSFGAISDIDVVVTDAGAPASFVEQLRERDVEVVIAE |