| Read Date | 2005-09-09 08:09:00 |
|---|---|
| Read Number | X0000057061184200509090809 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 6_C1040 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.6 | 0.9 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.6 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SR391 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 74 aa |
| Mass | 8.91 kD |
| ext | 17420 |
| pI | 5.33 |
| Name | UPF0346 protein yozE |
| Database References | NCBI UniProt |
| PFAM | PF06855 |
| PDB Structures | 2FJ6 (NMR) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGR |