| Read Date | 2007-05-22 09:23:00 |
|---|---|
| Read Number | X0000088461522200705220923 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1341 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| PEG MME 2000 | 8.5 | 20.0 % (w/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
| Nickel(II) chloride hexahydrate | 8.5 | 0.0 M | [Ni+2].[Cl-].[Cl-].O.O.O.… |
![]() | StR250 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 113 aa |
| Mass | 12.91 kD |
| ext | 22460 |
| pI | 6.04 |
| Name | Putative cytoplasmic protein |
| Database References | NCBI UniProt |
| PFAM | PF09313 |
| PDB Structures | 3DL3 (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MSHLRIPANWKVKRSTPFFTKENVPAALLSHHNTAAGVFGQLCVMEGTVTYYGFANETATEPEVKVVINAGQFATSPPQYWHRVELSDDARFNIHFWVEEDHQGEEMYQQKKA |