| Read Date | 2007-05-22 10:14:00 |
|---|---|
| Read Number | X0000088491328200705221014 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1520 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| di-Ammonium Tartrate | 7.0 | 0.7 M | O=C([O-])C(O)C(O)C([O-])=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BhR1 |
|---|---|
| Spine Status | aggregation screening |
| Length | 300 aa |
| Mass | 31.86 kD |
| ext | 7450 |
| pI | 4.64 |
| Name | Acetamidase |
| Database References | NCBI UniProt |
| PFAM | PF03069 |
| PDB Structures | 2II1 (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | MIRLSNENTIFFMDKENVPIASCQSGDTVIFETKDCFSDQITNEEQALTSIDFNRVNPATGPLYVEGARRGDMLEIEILDIKVGKQGVMTAAPGLGALGESLNSPTTKLFPIEGDDVVYSTGLRLPLQPMIGVIGTAPPGEPINNGTPGPHGGNLDTKDIKPGTTVYLPVEVDGALLALGDLHAAMGDGEILICGVEIAGTVTLKVNVKKERMFPLPALKTDTHFMTIASAETLDAAAVQATKNMATFLANRTALSIEEAGMLLSGAGDLYVSQIVNPLKTARFSLALHYFEKLGVDLCN |