| Read Date | 2007-05-25 09:11:00 |
|---|---|
| Read Number | X0000088621380200705250911 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1053 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.3 | 1.2 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.3 | 0.6 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | DrR85 |
|---|---|
| Spine Status | HSQC collected |
| Length | 188 aa |
| Mass | 19.69 kD |
| ext | 18910 |
| pI | 4.59 |
| Name | Probable 16S rRNA-processing protein rimM |
| Database References | NCBI UniProt |
| PFAM | PF05239 |
| PDB Structures | 3A1P (Best Match) |
| Gene | |
|---|---|
| Organism | Deinococcus radiodurans |
| Genus | Deinococcus |
| Species | radiodurans |
| Strain | |
| Sequence | MTRPEASGPPDATRLGHLLGPHGVQGGIKLYVLGDPAQVLALKRVYVESRGWLSLRRAEGMPPNLVLYLAGVSSREGAEELRGLQVYATDAELPDLEEGTFYYHDLRGLEVYGAGGERLGTVSDVMDAGHQDLLVVDYGGGTSFVPLQAPYVEVPLAGGKPGAVHLTADAPAGLIGPEPGEEDGAAES |