| Read Date | 2005-10-01 01:34:00 |
|---|---|
| Read Number | X0000057070679200510010134 |
| Week | 5 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | crystal |
| Cocktail | 6_C0326 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Calcium acetate | 7.0 | 0.1 M | [Ca+2].[O-]C(=O)C.[O-]C(=… |
| PEG 20000 | 7.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SR398 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 121 aa |
| Mass | 13.77 kD |
| ext | 7450 |
| pI | 5.24 |
| Name | YorW protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MLTDQEKIDLVNALDFVVIEPHTQSIYVHNDEKTNGVLAKVLHTISVDEYIESFKKGSLIDIFPAAMQEAGAEGFKDGQFVIMPKKFYVDQCYAMSKEIERLTNLNNLHNIKPNTYQGLIH |