 
    | Read Date | 2005-10-01 01:35:00 | 
|---|---|
| Read Number | X0000057070610200510010135 | 
| Week | 5 | 
| Verified Crystal | |
| 3-Way Classifier | other | 
| 10-Way Classifier | precip | 
| Cocktail | 6_C0813 | 
| Screen | HWI Generation 6 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.0 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… | 
| Rubidium chloride | 4.0 | 0.1 M | [Rb+].[Cl-] | 
| PEG 1000 | 4.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
|  | SR398 | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 121 aa | 
| Mass | 13.77 kD | 
| ext | 7450 | 
| pI | 5.24 | 
| Name | YorW protein | 
| Database References | NCBI UniProt | 
| PFAM | |
| PDB Structures | 
| Gene | |
|---|---|
| Organism | Bacillus subtilis | 
| Genus | Bacillus | 
| Species | subtilis | 
| Strain | |
| Sequence | MLTDQEKIDLVNALDFVVIEPHTQSIYVHNDEKTNGVLAKVLHTISVDEYIESFKKGSLIDIFPAAMQEAGAEGFKDGQFVIMPKKFYVDQCYAMSKEIERLTNLNNLHNIKPNTYQGLIH |