xtuition

X0000057070505200510010137

X0000057070505200510010137

Well
Read Date2005-10-01 01:37:00
Read NumberX0000057070505200510010137
Week5
Verified Crystal
3-Way Classifier crystal
10-Way Classifier clear
Cocktail6_C0127
ScreenHWI Generation 6
Cocktail: 6_C0127
Name pH Concentration SMILES
TAPS 9.0 0.1 M O=S(=O)(O)CCCNC(CO)(CO)CO
Potassium nitrate 9.0 0.9 M [K+].[O-][N+]([O-])=O
Sample: X000005707
NESGSR398
Spine StatusHSQC collected and crystal hits
Length121 aa
Mass13.77 kD
ext7450
pI5.24
Name
YorW protein
Database References NCBI UniProt
PFAM
PDB Structures
Sequence
Gene
OrganismBacillus subtilis
GenusBacillus
Speciessubtilis
Strain
Sequence
MLTDQEKIDLVNALDFVVIEPHTQSIYVHNDEKTNGVLAKVLHTISVDEYIESFKKGSLIDIFPAAMQEAGAEGFKDGQFVIMPKKFYVDQCYAMSKEIERLTNLNNLHNIKPNTYQGLIH