| Read Date | 2007-06-28 20:03:00 |
|---|---|
| Read Number | X0000088690640200706282003 |
| Week | 5 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 7_C1384 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Citric acid | 3.5 | 0.1 M | C(C(=O)O)C(CC(=O)O)(C(=O)… |
| PEG 3350 | 3.5 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | EwR127 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 110 aa |
| Mass | 12.71 kD |
| ext | 25440 |
| pI | 5.28 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF09313 |
| PDB Structures | 3BB6 (Best Match) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | MERIVMPANYVHTRTTPFWTKETAPASIWRRHLDAGTRQGVYPRLCVMQGTIRYYGYADETSPEPVETLTIEAGQFGVFPPEKWHRIEALSDDTLFNVDFYVDPKILIEG |