| Read Date | 2007-05-31 10:34:00 |
|---|---|
| Read Number | X0000088711148200705311034 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1511 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Lithium sulfate monohydrate | 7.0 | 1.5 M | [Li+].[Li+].[O-]S([O-])(=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | MR91 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 56 aa |
| Mass | 6.40 kD |
| ext | 11460 |
| pI | 7.88 |
| Name | UPF0339 protein NMA1193/NMA1859 |
| Database References | NCBI UniProt |
| PFAM | PF07411 |
| PDB Structures | 3BID (Xray) |
| Gene | |
|---|---|
| Organism | Neisseria meningitidis |
| Genus | Neisseria |
| Species | meningitidis |
| Strain | |
| Sequence | MYFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEV |