| Read Date | 2005-07-22 19:32:00 |
|---|---|
| Read Number | X0000051870154200507221932 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | clear |
| Cocktail | 5_C1251 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium phosphate monobasic | 4.2 | 0.4 M | [O-]P(=O)(O)O.[NH4+] |
![]() | JR32 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 182 aa |
| Mass | 21.89 kD |
| ext | 34380 |
| pI | 9.41 |
| Name | Hypothetical protein PH0736 |
| Database References | NCBI UniProt |
| PFAM | PF00583 |
| PDB Structures | 2GAN (Xray) |
| Gene | |
|---|---|
| Organism | Pyrococcus horikoshii |
| Genus | Pyrococcus |
| Species | horikoshi |
| Strain | |
| Sequence | MEGVKKIKNPSTVKDELLELMFRIYRSTNGKYPALEWVKRKPNPNDFDGFREVYEPFLKFRLSQEFDELYTYQKDNRIIGTIALVYKRIKEKGIWWVPEELMNEKVGLIEFFVVDPEFQGKGIGSTLLEFAVKRLRSLGKDPYVVTFPNLEAYSYYYMKKGFREIMRYKEFVILKFNHKKFQ |