| Read Date | 2007-05-31 11:06:00 |
|---|---|
| Read Number | X0000088751376200705311106 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1052 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.6 | 1.6 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.6 | 0.2 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | ZR279 |
|---|---|
| Spine Status | HSQC collected |
| Length | 104 aa |
| Mass | 11.41 kD |
| ext | 4470 |
| pI | 4.81 |
| Name | Assimilatory nitrite reductase |
| Database References | NCBI UniProt |
| PFAM | PF13806 |
| PDB Structures | 3C0D (Best Match) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGTIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL |