| Read Date | 2007-05-31 11:07:00 |
|---|---|
| Read Number | X0000088751270200705311107 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | clear |
| Cocktail | 7_C0942 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Potassium acetate | 10.0 | 0.1 M | CC(=O)[O-].[K+] |
| PEG 400 | 10.0 | 20.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | ZR279 |
|---|---|
| Spine Status | HSQC collected |
| Length | 104 aa |
| Mass | 11.41 kD |
| ext | 4470 |
| pI | 4.81 |
| Name | Assimilatory nitrite reductase |
| Database References | NCBI UniProt |
| PFAM | PF13806 |
| PDB Structures | 3C0D (Best Match) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGTIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL |