| Read Date | 2007-06-08 07:33:00 |
|---|---|
| Read Number | X0000088881328200706080733 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1520 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| di-Ammonium Tartrate | 7.0 | 0.7 M | O=C([O-])C(O)C(O)C([O-])=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | EwR120 |
|---|---|
| Spine Status | NMR structure |
| Length | 122 aa |
| Mass | 13.40 kD |
| ext | 16960 |
| pI | 4.28 |
| Name | Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) |
| Database References | NCBI UniProt |
| PFAM | PF13806 |
| PDB Structures | 2JZA (NMR) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | MSQWTTVCKLDDILPGTGVCALVEQQQIAVFRPRNDEQVYAISNIDPFAQASVLSRGIVAEHQDDLWVASPLKKQHFRLYDGFCLEDGAYSVAAYDTQVTNGNVQISIADSDVAVDNSQPLP |