| Read Date | 2007-06-15 09:05:00 |
|---|---|
| Read Number | X0000089401344200706150905 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1524 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| di-Ammonium Tartrate | 8.5 | 1.4 M | O=C([O-])C(O)C(O)C([O-])=… |
![]() | SR384 |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 77 aa |
| Mass | 8.81 kD |
| ext | 1490 |
| pI | 9.79 |
| Name | UPF0291 protein ynzC |
| Database References | NCBI UniProt |
| PFAM | PF05979 |
| PDB Structures | 2HEP (NMR) 2JVD (NMR) 3BHP (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSVKIIDPEGNDVTPEKLKREQRNNKLH |