| Read Date | 2007-06-21 09:47:00 |
|---|---|
| Read Number | X0000089761185200706210947 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0081 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Magnesium sulfate heptahydrate | 9.0 | 1.6 M | [Mg+2].[O-]S([O-])(=O)=O.… |
![]() | BeR132 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 107 aa |
| Mass | 11.42 kD |
| ext | 0 |
| pI | 6.40 |
| Name | Primosomal replication protein n |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 3KLW (Xray) |
| Gene | |
|---|---|
| Organism | Bordetella pertussis |
| Genus | Bordetella |
| Species | bronchiseptica |
| Strain | |
| Sequence | MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGHPRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGRDPLVG |