| Read Date | 2007-07-13 09:37:00 |
|---|---|
| Read Number | X0000090421357200707130937 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0088 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Manganese chloride tetrahydrate | 8.0 | 3.8 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | StR96A |
|---|---|
| Spine Status | good HSQC collected |
| Length | 59 aa |
| Mass | 6.63 kD |
| ext | 11460 |
| pI | 5.12 |
| Name | Endonuclease VIII (DNA glycosylase/AP lyase Nei) (EC 3.2.2.-)(EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase Nei) |
| Database References | UniProt |
| PFAM | PF06004 |
| PDB Structures | 2RD1 (Best Match) |
| Gene | |
|---|---|
| Organism | Salmonella typhimurium |
| Genus | Salmonella |
| Species | typhimurium |
| Strain | |
| Sequence | MTTTYTMTTRTGEIIETQGKPEVDTATGMTKYADVYGYHRVMKTSEIVQTTEGASKLDW |