| Read Date | 2007-07-13 09:19:00 |
|---|---|
| Read Number | X0000090451328200707130919 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1520 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| di-Ammonium Tartrate | 7.0 | 0.7 M | O=C([O-])C(O)C(O)C([O-])=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | VpR80A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 159 aa |
| Mass | 18.23 kD |
| ext | 13410 |
| pI | 7.93 |
| Name | Rare lipoprotein B |
| Database References | UniProt |
| PFAM | PF04390 |
| PDB Structures | 2R76 (Best Match) |
| Gene | |
|---|---|
| Organism | Vibrio parahaemolyticus |
| Genus | Vibrio |
| Species | parahaemolyticus |
| Strain | |
| Sequence | MGFHLRGEYSVPEELHTMSFSSYDEYSKLTRYVRSQLQLNKVDLVQPSSSVPNLHLIKATMDERTLSLYQNSRAAEKELTYVVQYRVTIPGFGSKNFTTTVNRNYLDNPLTALAKSVERDVIEDEMRQQAAKQMMRQLGRIRAEYEAGQIAAPTEKTNS |