| Read Date | 2007-07-17 14:35:00 |
|---|---|
| Read Number | X0000090631496200707171435 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 7_C1526 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 1.2 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | PpR154 |
|---|---|
| Spine Status | aggregation screening |
| Length | 218 aa |
| Mass | 24.02 kD |
| ext | 21430 |
| pI | 6.04 |
| Name | HD domain protein |
| Database References | NCBI UniProt |
| PFAM | PF01966 |
| PDB Structures | 3GW7 (Best Match) |
| Gene | |
|---|---|
| Organism | Pseudomonas putida |
| Genus | Pseudomonas |
| Species | putida |
| Strain | |
| Sequence | MTREAFAPYQCLATDLLKYLPSDQNDGSHDLAHIHRVWVNAHRIQRVEGGDLEILLAATVLHDCVAVEKHSPLRGQASTLSANKAASVLAEMGWPSGRVEQVVHAIKTHSYSAGFEPLTREACILQDSDRLDAIGAVGIARCFYVAGRMGSALYDFENPFAQQRAYQDGAYAIEHFQTKLLKLASGFKTQEGARLAAERHTRLETFLTQFMDEITGAG |