| Read Date | 2007-07-20 09:46:00 |
|---|---|
| Read Number | X0000090731524200707200946 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1533 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium acetate | 7.0 | 4.0 M | O=C(O)C.N |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | AtR183 |
|---|---|
| Spine Status | aggregation screening |
| Length | 214 aa |
| Mass | 23.09 kD |
| ext | 8480 |
| pI | 5.85 |
| Name | Hypothetical protein Atu1043 (AGR_C_1925p) |
| Database References | NCBI UniProt |
| PFAM | PF01966 |
| PDB Structures | 3GW7 (Best Match) |
| Gene | |
|---|---|
| Organism | Agrobacterium tumefaciens |
| Genus | Agrobacterium |
| Species | tumefaciens |
| Strain | |
| Sequence | MIAAEAFAPHAALAQDLIPHAADTGDGSHDLAHIHRVFRNAMRIHAGEGGDGNVLAASVLLHDCVAVEKNSPLRAQASRLAAEKASGILAGLGWQKQDIDAAAHAITTHSFSANIEPQTLEAKILQDADRLDAIGMVGAARCFYIAGRMGSALYDPADPLAKERPLDDRAFAIDHFETKLFKLADGFRTETGRQMAKARHERLKQVLDLFLDEI |