| Read Date | 2007-07-30 10:05:00 |
|---|---|
| Read Number | X0000090901168200707301005 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1036 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 6.9 | 0.3 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 6.9 | 0.5 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | MrR83 |
|---|---|
| Spine Status | HSQC collected |
| Length | 176 aa |
| Mass | 19.95 kD |
| ext | 20400 |
| pI | 8.82 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2LCQ (Best Match) |
| Gene | |
|---|---|
| Organism | Methanococcus maripaludis |
| Genus | Methanococcus |
| Species | maripaludis |
| Strain | |
| Sequence | MIKILDASAFIHGYNPSIEDGEHYTTNGIVSEVVSKEDIVKLAIEYGKLKILDPKPETIEKVVKTSIETGDTISNNDIEILALAIDLGGTLYTDDYGLQNVSKKLKINYENIVSAGSKDDFVWKKICKGCKKMYPINYLDEECEVCGSPLYRKMVKNRLKKGKKFYDKKKKPKKLF |